Protein Description: protein phosphatase methylesterase 1
Gene Name: PPME1
Alternative Gene Name: PME-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030718: 98%, ENSRNOG00000017227: 97%
Entrez Gene ID: 51400
Uniprot ID: Q9Y570
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PPME1
Alternative Gene Name: PME-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030718: 98%, ENSRNOG00000017227: 97%
Entrez Gene ID: 51400
Uniprot ID: Q9Y570
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | AIAVHTASSNLVPSLLGLCMIDVVEGTAMDALNSMQNFLRGRPKTFKSLENAIEWSVKSGQIRNLESARVSMVGQVKQCEGITSPEGSKSIVEGIIEEE |
| Documents & Links for Anti PPME1 pAb (ATL-HPA064396) | |
| Datasheet | Anti PPME1 pAb (ATL-HPA064396) Datasheet (External Link) |
| Vendor Page | Anti PPME1 pAb (ATL-HPA064396) at Atlas |
| Documents & Links for Anti PPME1 pAb (ATL-HPA064396) | |
| Datasheet | Anti PPME1 pAb (ATL-HPA064396) Datasheet (External Link) |
| Vendor Page | Anti PPME1 pAb (ATL-HPA064396) |