Protein Description: protein phosphatase, Mg2+/Mn2+ dependent, 1M
Gene Name: PPM1M
Alternative Gene Name: FLJ32332, PP2Ceta
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020253: 90%, ENSRNOG00000046535: 90%
Entrez Gene ID: 132160
Uniprot ID: Q96MI6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PPM1M
Alternative Gene Name: FLJ32332, PP2Ceta
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020253: 90%, ENSRNOG00000046535: 90%
Entrez Gene ID: 132160
Uniprot ID: Q96MI6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | AFQECDEVIGRELEASGQMGGCTALVAVSLQGKLYMANA |
| Documents & Links for Anti PPM1M pAb (ATL-HPA062291) | |
| Datasheet | Anti PPM1M pAb (ATL-HPA062291) Datasheet (External Link) |
| Vendor Page | Anti PPM1M pAb (ATL-HPA062291) at Atlas |
| Documents & Links for Anti PPM1M pAb (ATL-HPA062291) | |
| Datasheet | Anti PPM1M pAb (ATL-HPA062291) Datasheet (External Link) |
| Vendor Page | Anti PPM1M pAb (ATL-HPA062291) |