Protein Description: peptidylprolyl isomerase (cyclophilin)-like 1
Gene Name: PPIL1
Alternative Gene Name: CYPL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024007: 98%, ENSRNOG00000000523: 98%
Entrez Gene ID: 51645
Uniprot ID: Q9Y3C6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PPIL1
Alternative Gene Name: CYPL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024007: 98%, ENSRNOG00000000523: 98%
Entrez Gene ID: 51645
Uniprot ID: Q9Y3C6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | KHTIFGRVCQGIGMVNRVGMVETNSQDRPVDDVKIIKAYPSG |
| Documents & Links for Anti PPIL1 pAb (ATL-HPA062916) | |
| Datasheet | Anti PPIL1 pAb (ATL-HPA062916) Datasheet (External Link) |
| Vendor Page | Anti PPIL1 pAb (ATL-HPA062916) at Atlas |
| Documents & Links for Anti PPIL1 pAb (ATL-HPA062916) | |
| Datasheet | Anti PPIL1 pAb (ATL-HPA062916) Datasheet (External Link) |
| Vendor Page | Anti PPIL1 pAb (ATL-HPA062916) |