Anti PPIH pAb (ATL-HPA059019)

Atlas Antibodies

Catalog No: ATL-HPA059019-100

• 
• 

Product Description

Protein Description: peptidylprolyl isomerase H (cyclophilin H)
Gene Name: PPIH
Alternative Gene Name: CYP-20, CYPH, MGC5016, SnuCyp-20, USA-CYP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033036: 100%, ENSRNOG00000008489: 100%
Entrez Gene ID: 10465
Uniprot ID: O43447
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VFGKIIDGLLVMRKIENVPTGPNNKPKLPVVISQCGEM
• Gene Sequence: VFGKIIDGLLVMRKIENVPTGPNNKPKLPVVISQCGEM
• Gene ID - Mouse: ENSMUSG00000033036
• Gene ID - Rat: ENSRNOG00000008489
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.