![Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/84347/153645/atl-hpa019692_anti-ppid-pab-atl-hpa019692_35274__86826.1681103825.jpg?c=2 "Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4")
Protein Description: peptidylprolyl isomerase D
Gene Name: PPID
Alternative Gene Name: CYP-40
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027804: 93%, ENSRNOG00000037230: 93%
Entrez Gene ID: 5481
Uniprot ID: Q08752
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PPID
Alternative Gene Name: CYP-40
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027804: 93%, ENSRNOG00000037230: 93%
Entrez Gene ID: 5481
Uniprot ID: Q08752
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | IDSCLEALELDPSNTKALYRRAQGWQGLKEYDQALADLKKAQGIAPEDKAIQAELLKVKQKIKAQKDKEKAV |
| Documents & Links for Anti PPID pAb (ATL-HPA019692) | |
| Datasheet | Anti PPID pAb (ATL-HPA019692) Datasheet (External Link) |
| Vendor Page | Anti PPID pAb (ATL-HPA019692) at Atlas |
| Documents & Links for Anti PPID pAb (ATL-HPA019692) | |
| Datasheet | Anti PPID pAb (ATL-HPA019692) Datasheet (External Link) |
| Vendor Page | Anti PPID pAb (ATL-HPA019692) |