Protein Description: peptidylprolyl isomerase D
Gene Name: PPID
Alternative Gene Name: CYP-40
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027804: 95%, ENSRNOG00000037230: 95%
Entrez Gene ID: 5481
Uniprot ID: Q08752
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PPID
Alternative Gene Name: CYP-40
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027804: 95%, ENSRNOG00000037230: 95%
Entrez Gene ID: 5481
Uniprot ID: Q08752
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | FITTVPTPHLDGKHVVFGQVIKGIGVARILENVEVKGEKPAKLCVIAECGELKEGDDGGIFPKDGSGDSHPDFPE |
Documents & Links for Anti PPID pAb (ATL-HPA019520 w/enhanced validation) | |
Datasheet | Anti PPID pAb (ATL-HPA019520 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti PPID pAb (ATL-HPA019520 w/enhanced validation) at Atlas |
Documents & Links for Anti PPID pAb (ATL-HPA019520 w/enhanced validation) | |
Datasheet | Anti PPID pAb (ATL-HPA019520 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti PPID pAb (ATL-HPA019520 w/enhanced validation) |