Anti PPARGC1A pAb (ATL-HPA063136)

Catalog No:
ATL-HPA063136-25
$395.00

Description

Product Description

Protein Description: peroxisome proliferator-activated receptor gamma, coactivator 1 alpha
Gene Name: PPARGC1A
Alternative Gene Name: PGC1, PGC1A, PPARGC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029167: 90%, ENSRNOG00000004473: 90%
Entrez Gene ID: 10891
Uniprot ID: Q9UBK2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FGHPSQAVFDDEADKTGELRDSDFSNEQFSKLPMFINSGLAMDGLFDDSEDESDKLSYPWDGTQSYSLFNVSPSCSSFNSPCRDSVSRPKSL
Gene Sequence FGHPSQAVFDDEADKTGELRDSDFSNEQFSKLPMFINSGLAMDGLFDDSEDESDKLSYPWDGTQSYSLFNVSPSCSSFNSPCRDSVSRPKSL
Gene ID - Mouse ENSMUSG00000029167
Gene ID - Rat ENSRNOG00000004473
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti PPARGC1A pAb (ATL-HPA063136)
Datasheet Anti PPARGC1A pAb (ATL-HPA063136) Datasheet (External Link)
Vendor Page Anti PPARGC1A pAb (ATL-HPA063136) at Atlas Antibodies

Documents & Links for Anti PPARGC1A pAb (ATL-HPA063136)
Datasheet Anti PPARGC1A pAb (ATL-HPA063136) Datasheet (External Link)
Vendor Page Anti PPARGC1A pAb (ATL-HPA063136)

Product Description

Protein Description: peroxisome proliferator-activated receptor gamma, coactivator 1 alpha
Gene Name: PPARGC1A
Alternative Gene Name: PGC1, PGC1A, PPARGC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029167: 90%, ENSRNOG00000004473: 90%
Entrez Gene ID: 10891
Uniprot ID: Q9UBK2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FGHPSQAVFDDEADKTGELRDSDFSNEQFSKLPMFINSGLAMDGLFDDSEDESDKLSYPWDGTQSYSLFNVSPSCSSFNSPCRDSVSRPKSL
Gene Sequence FGHPSQAVFDDEADKTGELRDSDFSNEQFSKLPMFINSGLAMDGLFDDSEDESDKLSYPWDGTQSYSLFNVSPSCSSFNSPCRDSVSRPKSL
Gene ID - Mouse ENSMUSG00000029167
Gene ID - Rat ENSRNOG00000004473
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti PPARGC1A pAb (ATL-HPA063136)
Datasheet Anti PPARGC1A pAb (ATL-HPA063136) Datasheet (External Link)
Vendor Page Anti PPARGC1A pAb (ATL-HPA063136) at Atlas Antibodies

Documents & Links for Anti PPARGC1A pAb (ATL-HPA063136)
Datasheet Anti PPARGC1A pAb (ATL-HPA063136) Datasheet (External Link)
Vendor Page Anti PPARGC1A pAb (ATL-HPA063136)