Protein Description: peroxisome proliferator-activated receptor gamma, coactivator 1 alpha
Gene Name: PPARGC1A
Alternative Gene Name: PGC1, PGC1A, PPARGC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029167: 90%, ENSRNOG00000004473: 90%
Entrez Gene ID: 10891
Uniprot ID: Q9UBK2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PPARGC1A
Alternative Gene Name: PGC1, PGC1A, PPARGC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029167: 90%, ENSRNOG00000004473: 90%
Entrez Gene ID: 10891
Uniprot ID: Q9UBK2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | FGHPSQAVFDDEADKTGELRDSDFSNEQFSKLPMFINSGLAMDGLFDDSEDESDKLSYPWDGTQSYSLFNVSPSCSSFNSPCRDSVSRPKSL |
Documents & Links for Anti PPARGC1A pAb (ATL-HPA063136) | |
Datasheet | Anti PPARGC1A pAb (ATL-HPA063136) Datasheet (External Link) |
Vendor Page | Anti PPARGC1A pAb (ATL-HPA063136) at Atlas |
Documents & Links for Anti PPARGC1A pAb (ATL-HPA063136) | |
Datasheet | Anti PPARGC1A pAb (ATL-HPA063136) Datasheet (External Link) |
Vendor Page | Anti PPARGC1A pAb (ATL-HPA063136) |