Protein Description: peroxisome proliferator-activated receptor gamma
Gene Name: PPARG
Alternative Gene Name: NR1C3, PPARG1, PPARG2, PPARgamma
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000440: 98%, ENSRNOG00000008839: 98%
Entrez Gene ID: 5468
Uniprot ID: P37231
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PPARG
Alternative Gene Name: NR1C3, PPARG1, PPARG2, PPARgamma
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000440: 98%, ENSRNOG00000008839: 98%
Entrez Gene ID: 5468
Uniprot ID: P37231
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | DYKYDLKLQEYQSAIKVEPASPPYYSEKTQLYNKPHEEPSNSLMAIECRVC |
| Documents & Links for Anti PPARG pAb (ATL-HPA063663 w/enhanced validation) | |
| Datasheet | Anti PPARG pAb (ATL-HPA063663 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti PPARG pAb (ATL-HPA063663 w/enhanced validation) at Atlas |
| Documents & Links for Anti PPARG pAb (ATL-HPA063663 w/enhanced validation) | |
| Datasheet | Anti PPARG pAb (ATL-HPA063663 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti PPARG pAb (ATL-HPA063663 w/enhanced validation) |