Anti PPARA pAb (ATL-HPA058901)

Catalog No:
ATL-HPA058901-25
$328.00

Description

Product Description

Protein Description: peroxisome proliferator-activated receptor alpha
Gene Name: PPARA
Alternative Gene Name: hPPAR, NR1C1, PPAR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022383: 91%, ENSRNOG00000021463: 93%
Entrez Gene ID: 5465
Uniprot ID: Q07869
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FGRMPRSEKAKLKAEILTCEHDIEDSETADLKSLAKRIYEAYLKN
Gene Sequence FGRMPRSEKAKLKAEILTCEHDIEDSETADLKSLAKRIYEAYLKN
Gene ID - Mouse ENSMUSG00000022383
Gene ID - Rat ENSRNOG00000021463
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti PPARA pAb (ATL-HPA058901)
Datasheet Anti PPARA pAb (ATL-HPA058901) Datasheet (External Link)
Vendor Page Anti PPARA pAb (ATL-HPA058901) at Atlas Antibodies

Documents & Links for Anti PPARA pAb (ATL-HPA058901)
Datasheet Anti PPARA pAb (ATL-HPA058901) Datasheet (External Link)
Vendor Page Anti PPARA pAb (ATL-HPA058901)

Product Description

Protein Description: peroxisome proliferator-activated receptor alpha
Gene Name: PPARA
Alternative Gene Name: hPPAR, NR1C1, PPAR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022383: 91%, ENSRNOG00000021463: 93%
Entrez Gene ID: 5465
Uniprot ID: Q07869
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FGRMPRSEKAKLKAEILTCEHDIEDSETADLKSLAKRIYEAYLKN
Gene Sequence FGRMPRSEKAKLKAEILTCEHDIEDSETADLKSLAKRIYEAYLKN
Gene ID - Mouse ENSMUSG00000022383
Gene ID - Rat ENSRNOG00000021463
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti PPARA pAb (ATL-HPA058901)
Datasheet Anti PPARA pAb (ATL-HPA058901) Datasheet (External Link)
Vendor Page Anti PPARA pAb (ATL-HPA058901) at Atlas Antibodies

Documents & Links for Anti PPARA pAb (ATL-HPA058901)
Datasheet Anti PPARA pAb (ATL-HPA058901) Datasheet (External Link)
Vendor Page Anti PPARA pAb (ATL-HPA058901)