Description
Product Description
Protein Description: protein phosphatase 2C-like domain containing 1
Gene Name: PP2D1
Alternative Gene Name: C3orf48, FLJ25449
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044957: 72%, ENSRNOG00000004719: 71%
Entrez Gene ID: 151649
Uniprot ID: A8MPX8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PP2D1
Alternative Gene Name: C3orf48, FLJ25449
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044957: 72%, ENSRNOG00000004719: 71%
Entrez Gene ID: 151649
Uniprot ID: A8MPX8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PSYQMTTDEQQIINSFYTVFREEYAAIEDLFSAINKTEAVRCEYEDTHKAFAKAFWRMDRLLGLGRKEVSRVQWSGC |
Gene Sequence | PSYQMTTDEQQIINSFYTVFREEYAAIEDLFSAINKTEAVRCEYEDTHKAFAKAFWRMDRLLGLGRKEVSRVQWSGC |
Gene ID - Mouse | ENSMUSG00000044957 |
Gene ID - Rat | ENSRNOG00000004719 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti PP2D1 pAb (ATL-HPA066083) | |
Datasheet | Anti PP2D1 pAb (ATL-HPA066083) Datasheet (External Link) |
Vendor Page | Anti PP2D1 pAb (ATL-HPA066083) at Atlas Antibodies |
Documents & Links for Anti PP2D1 pAb (ATL-HPA066083) | |
Datasheet | Anti PP2D1 pAb (ATL-HPA066083) Datasheet (External Link) |
Vendor Page | Anti PP2D1 pAb (ATL-HPA066083) |