Anti POU5F2 pAb (ATL-HPA077615)

Atlas Antibodies

Catalog No: ATL-HPA077615-25

• 
• 

Product Description

Protein Description: POU domain class 5, transcription factor 2
Gene Name: POU5F2
Alternative Gene Name: FLJ25680, SPRM-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000093668: 73%, ENSRNOG00000062285: 74%
Entrez Gene ID: 134187
Uniprot ID: Q8N7G0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QQLSVANMWKLRPLLKKWLKEVEAENLLGLCKMEMILQQSGKWRRASRERRIGNSLEKFFQRCPKP
• Gene Sequence: QQLSVANMWKLRPLLKKWLKEVEAENLLGLCKMEMILQQSGKWRRASRERRIGNSLEKFFQRCPKP
• Gene ID - Mouse: ENSMUSG00000093668
• Gene ID - Rat: ENSRNOG00000062285
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.