Description
Product Description
Protein Description: POU domain class 5, transcription factor 2
Gene Name: POU5F2
Alternative Gene Name: FLJ25680, SPRM-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000093668: 73%, ENSRNOG00000062285: 74%
Entrez Gene ID: 134187
Uniprot ID: Q8N7G0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: POU5F2
Alternative Gene Name: FLJ25680, SPRM-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000093668: 73%, ENSRNOG00000062285: 74%
Entrez Gene ID: 134187
Uniprot ID: Q8N7G0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | QQLSVANMWKLRPLLKKWLKEVEAENLLGLCKMEMILQQSGKWRRASRERRIGNSLEKFFQRCPKP |
Gene Sequence | QQLSVANMWKLRPLLKKWLKEVEAENLLGLCKMEMILQQSGKWRRASRERRIGNSLEKFFQRCPKP |
Gene ID - Mouse | ENSMUSG00000093668 |
Gene ID - Rat | ENSRNOG00000062285 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti POU5F2 pAb (ATL-HPA077615) | |
Datasheet | Anti POU5F2 pAb (ATL-HPA077615) Datasheet (External Link) |
Vendor Page | Anti POU5F2 pAb (ATL-HPA077615) at Atlas Antibodies |
Documents & Links for Anti POU5F2 pAb (ATL-HPA077615) | |
Datasheet | Anti POU5F2 pAb (ATL-HPA077615) Datasheet (External Link) |
Vendor Page | Anti POU5F2 pAb (ATL-HPA077615) |