Protein Description: POU class 3 homeobox 4
Gene Name: POU3F4
Alternative Gene Name: BRN4, DFN3, DFNX2, OTF9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056854: 100%, ENSRNOG00000002784: 100%
Entrez Gene ID: 5456
Uniprot ID: P49335
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: POU3F4
Alternative Gene Name: BRN4, DFN3, DFNX2, OTF9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056854: 100%, ENSRNOG00000002784: 100%
Entrez Gene ID: 5456
Uniprot ID: P49335
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | SNGHPLGHHWVTSLSDGGPWSSTLATSPLDQQDVKPGREDLQLGAIIHHR |
| Documents & Links for Anti POU3F4 pAb (ATL-HPA062295) | |
| Datasheet | Anti POU3F4 pAb (ATL-HPA062295) Datasheet (External Link) |
| Vendor Page | Anti POU3F4 pAb (ATL-HPA062295) at Atlas |
| Documents & Links for Anti POU3F4 pAb (ATL-HPA062295) | |
| Datasheet | Anti POU3F4 pAb (ATL-HPA062295) Datasheet (External Link) |
| Vendor Page | Anti POU3F4 pAb (ATL-HPA062295) |