Anti POU3F2 pAb (ATL-HPA056261)

Catalog No:
ATL-HPA056261-25
$303.00

On sale now! 25% off. Add item to cart to see discounted price. Valid thru Mar 2025.

Protein Description: POU class 3 homeobox 2
Gene Name: POU3F2
Alternative Gene Name: BRN2, OCT7, OTF7, POUF3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000095139: 100%, ENSRNOG00000006908: 100%
Entrez Gene ID: 5454
Uniprot ID: P20265
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence ASNHYSLLTSSASIVHAEPPGGMQQGAGGYREAQSLVQGDYGALQSNGHP
Gene ID - Mouse ENSMUSG00000095139
Gene ID - Rat ENSMUSG00000095139
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Documents & Links for Anti POU3F2 pAb (ATL-HPA056261)
Datasheet Anti POU3F2 pAb (ATL-HPA056261) Datasheet (External Link)
Vendor Page Anti POU3F2 pAb (ATL-HPA056261) at Atlas

Documents & Links for Anti POU3F2 pAb (ATL-HPA056261)
Datasheet Anti POU3F2 pAb (ATL-HPA056261) Datasheet (External Link)
Vendor Page Anti POU3F2 pAb (ATL-HPA056261)