Protein Description: POU class 3 homeobox 2
Gene Name: POU3F2
Alternative Gene Name: BRN2, OCT7, OTF7, POUF3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000095139: 100%, ENSRNOG00000006908: 100%
Entrez Gene ID: 5454
Uniprot ID: P20265
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: POU3F2
Alternative Gene Name: BRN2, OCT7, OTF7, POUF3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000095139: 100%, ENSRNOG00000006908: 100%
Entrez Gene ID: 5454
Uniprot ID: P20265
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | ASNHYSLLTSSASIVHAEPPGGMQQGAGGYREAQSLVQGDYGALQSNGHP |
| Documents & Links for Anti POU3F2 pAb (ATL-HPA056261) | |
| Datasheet | Anti POU3F2 pAb (ATL-HPA056261) Datasheet (External Link) |
| Vendor Page | Anti POU3F2 pAb (ATL-HPA056261) at Atlas |
| Documents & Links for Anti POU3F2 pAb (ATL-HPA056261) | |
| Datasheet | Anti POU3F2 pAb (ATL-HPA056261) Datasheet (External Link) |
| Vendor Page | Anti POU3F2 pAb (ATL-HPA056261) |