Description
Product Description
Protein Description: POU class 2 homeobox 3
Gene Name: POU2F3
Alternative Gene Name: Epoc-1, OCT11, PLA-1, Skn-1a
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032015: 93%, ENSRNOG00000009118: 90%
Entrez Gene ID: 25833
Uniprot ID: Q9UKI9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: POU2F3
Alternative Gene Name: Epoc-1, OCT11, PLA-1, Skn-1a
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032015: 93%, ENSRNOG00000009118: 90%
Entrez Gene ID: 25833
Uniprot ID: Q9UKI9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PVHSTMPGTVTSSCSPGNNSRPSSPGSGLHASSPTASQNNSKAAVNSASSFNSSGSWYRWNHSTYL |
Gene Sequence | PVHSTMPGTVTSSCSPGNNSRPSSPGSGLHASSPTASQNNSKAAVNSASSFNSSGSWYRWNHSTYL |
Gene ID - Mouse | ENSMUSG00000032015 |
Gene ID - Rat | ENSRNOG00000009118 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti POU2F3 pAb (ATL-HPA073468) | |
Datasheet | Anti POU2F3 pAb (ATL-HPA073468) Datasheet (External Link) |
Vendor Page | Anti POU2F3 pAb (ATL-HPA073468) at Atlas Antibodies |
Documents & Links for Anti POU2F3 pAb (ATL-HPA073468) | |
Datasheet | Anti POU2F3 pAb (ATL-HPA073468) Datasheet (External Link) |
Vendor Page | Anti POU2F3 pAb (ATL-HPA073468) |