![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/101224/181297/atl-hpa073998_anti-pou2f2-pab-atl-hpa073998-wenhanced-validation_62965__74927.1681137591.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil")
Protein Description: POU class 2 homeobox 2
Gene Name: POU2F2
Alternative Gene Name: OCT2, OTF2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000008496: 94%, ENSRNOG00000055650: 94%
Entrez Gene ID: 5452
Uniprot ID: P09086
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: POU2F2
Alternative Gene Name: OCT2, OTF2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000008496: 94%, ENSRNOG00000055650: 94%
Entrez Gene ID: 5452
Uniprot ID: P09086
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | MVHSSMGAPEIRMSKPLEAEKQGLDSPSEHTDTERNGPDTNHQNPQNKTSP |
| Documents & Links for Anti POU2F2 pAb (ATL-HPA073998 w/enhanced validation) | |
| Datasheet | Anti POU2F2 pAb (ATL-HPA073998 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti POU2F2 pAb (ATL-HPA073998 w/enhanced validation) at Atlas |
| Documents & Links for Anti POU2F2 pAb (ATL-HPA073998 w/enhanced validation) | |
| Datasheet | Anti POU2F2 pAb (ATL-HPA073998 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti POU2F2 pAb (ATL-HPA073998 w/enhanced validation) |