Description
Product Description
Protein Description: POU class 2 homeobox 2
Gene Name: POU2F2
Alternative Gene Name: OCT2, OTF2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000008496: 94%, ENSRNOG00000055650: 94%
Entrez Gene ID: 5452
Uniprot ID: P09086
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: POU2F2
Alternative Gene Name: OCT2, OTF2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000008496: 94%, ENSRNOG00000055650: 94%
Entrez Gene ID: 5452
Uniprot ID: P09086
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MVHSSMGAPEIRMSKPLEAEKQGLDSPSEHTDTERNGPDTNHQNPQNKTSP |
Gene Sequence | MVHSSMGAPEIRMSKPLEAEKQGLDSPSEHTDTERNGPDTNHQNPQNKTSP |
Gene ID - Mouse | ENSMUSG00000008496 |
Gene ID - Rat | ENSRNOG00000055650 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti POU2F2 pAb (ATL-HPA062096) | |
Datasheet | Anti POU2F2 pAb (ATL-HPA062096) Datasheet (External Link) |
Vendor Page | Anti POU2F2 pAb (ATL-HPA062096) at Atlas Antibodies |
Documents & Links for Anti POU2F2 pAb (ATL-HPA062096) | |
Datasheet | Anti POU2F2 pAb (ATL-HPA062096) Datasheet (External Link) |
Vendor Page | Anti POU2F2 pAb (ATL-HPA062096) |