Protein Description: POU class 2 homeobox 1
Gene Name: POU2F1
Alternative Gene Name: OCT1, OTF1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026565: 94%, ENSRNOG00000003581: 95%
Entrez Gene ID: 5451
Uniprot ID: P14859
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: POU2F1
Alternative Gene Name: OCT1, OTF1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026565: 94%, ENSRNOG00000003581: 95%
Entrez Gene ID: 5451
Uniprot ID: P14859
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | TNGLDFQKQPVPVGGAISTAQAQAFLGHLHQVQLAGTSLQAAAQSLNVQSKSNEESGDSQQPSQPSQQPSVQAAIPQTQL |
| Documents & Links for Anti POU2F1 pAb (ATL-HPA064323) | |
| Datasheet | Anti POU2F1 pAb (ATL-HPA064323) Datasheet (External Link) |
| Vendor Page | Anti POU2F1 pAb (ATL-HPA064323) at Atlas |
| Documents & Links for Anti POU2F1 pAb (ATL-HPA064323) | |
| Datasheet | Anti POU2F1 pAb (ATL-HPA064323) Datasheet (External Link) |
| Vendor Page | Anti POU2F1 pAb (ATL-HPA064323) |