Anti POU2F1 pAb (ATL-HPA064323)

Catalog No:
ATL-HPA064323-25
$395.00

Description

Product Description

Protein Description: POU class 2 homeobox 1
Gene Name: POU2F1
Alternative Gene Name: OCT1, OTF1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026565: 94%, ENSRNOG00000003581: 95%
Entrez Gene ID: 5451
Uniprot ID: P14859
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TNGLDFQKQPVPVGGAISTAQAQAFLGHLHQVQLAGTSLQAAAQSLNVQSKSNEESGDSQQPSQPSQQPSVQAAIPQTQL
Gene Sequence TNGLDFQKQPVPVGGAISTAQAQAFLGHLHQVQLAGTSLQAAAQSLNVQSKSNEESGDSQQPSQPSQQPSVQAAIPQTQL
Gene ID - Mouse ENSMUSG00000026565
Gene ID - Rat ENSRNOG00000003581
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti POU2F1 pAb (ATL-HPA064323)
Datasheet Anti POU2F1 pAb (ATL-HPA064323) Datasheet (External Link)
Vendor Page Anti POU2F1 pAb (ATL-HPA064323) at Atlas Antibodies

Documents & Links for Anti POU2F1 pAb (ATL-HPA064323)
Datasheet Anti POU2F1 pAb (ATL-HPA064323) Datasheet (External Link)
Vendor Page Anti POU2F1 pAb (ATL-HPA064323)

Product Description

Protein Description: POU class 2 homeobox 1
Gene Name: POU2F1
Alternative Gene Name: OCT1, OTF1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026565: 94%, ENSRNOG00000003581: 95%
Entrez Gene ID: 5451
Uniprot ID: P14859
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TNGLDFQKQPVPVGGAISTAQAQAFLGHLHQVQLAGTSLQAAAQSLNVQSKSNEESGDSQQPSQPSQQPSVQAAIPQTQL
Gene Sequence TNGLDFQKQPVPVGGAISTAQAQAFLGHLHQVQLAGTSLQAAAQSLNVQSKSNEESGDSQQPSQPSQQPSVQAAIPQTQL
Gene ID - Mouse ENSMUSG00000026565
Gene ID - Rat ENSRNOG00000003581
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti POU2F1 pAb (ATL-HPA064323)
Datasheet Anti POU2F1 pAb (ATL-HPA064323) Datasheet (External Link)
Vendor Page Anti POU2F1 pAb (ATL-HPA064323) at Atlas Antibodies

Documents & Links for Anti POU2F1 pAb (ATL-HPA064323)
Datasheet Anti POU2F1 pAb (ATL-HPA064323) Datasheet (External Link)
Vendor Page Anti POU2F1 pAb (ATL-HPA064323)