Protein Description: protection of telomeres 1
Gene Name: POT1
Alternative Gene Name: DKFZp586D211, hPot1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000098835: 76%, ENSRNOG00000019986: 74%
Entrez Gene ID: 25913
Uniprot ID: Q9NUX5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: POT1
Alternative Gene Name: DKFZp586D211, hPot1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000098835: 76%, ENSRNOG00000019986: 74%
Entrez Gene ID: 25913
Uniprot ID: Q9NUX5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | LTFEGTLGAPIIPRTSSKYFNFTTEDHKMVEALRVWASTHMSPSWTLLKLCDVQPMQYFDLTCQLLGKAEVDGASFLLKVWDGTR |
| Documents & Links for Anti POT1 pAb (ATL-HPA068538) | |
| Datasheet | Anti POT1 pAb (ATL-HPA068538) Datasheet (External Link) |
| Vendor Page | Anti POT1 pAb (ATL-HPA068538) at Atlas |
| Documents & Links for Anti POT1 pAb (ATL-HPA068538) | |
| Datasheet | Anti POT1 pAb (ATL-HPA068538) Datasheet (External Link) |
| Vendor Page | Anti POT1 pAb (ATL-HPA068538) |