Anti PORCN pAb (ATL-HPA058413 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA058413-25

• 

Product Description

Protein Description: porcupine homolog (Drosophila)
Gene Name: PORCN
Alternative Gene Name: DHOF, MG61, por, PORC, PPN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031169: 99%, ENSRNOG00000004819: 99%
Entrez Gene ID: 64840
Uniprot ID: Q9H237
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AVSFHFSNYFVGFLSEATATLAGAGFTEEKDHLEWDLTVSKPLNVELPRSMVEVVTSWNLPMSYWLNNYVFKNAL
• Gene Sequence: AVSFHFSNYFVGFLSEATATLAGAGFTEEKDHLEWDLTVSKPLNVELPRSMVEVVTSWNLPMSYWLNNYVFKNAL
• Gene ID - Mouse: ENSMUSG00000031169
• Gene ID - Rat: ENSRNOG00000004819
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.