Anti PORCN pAb (ATL-HPA058413 w/enhanced validation)

Catalog No:
ATL-HPA058413-25
$303.00

Description

Product Description

Protein Description: porcupine homolog (Drosophila)
Gene Name: PORCN
Alternative Gene Name: DHOF, MG61, por, PORC, PPN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031169: 99%, ENSRNOG00000004819: 99%
Entrez Gene ID: 64840
Uniprot ID: Q9H237
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AVSFHFSNYFVGFLSEATATLAGAGFTEEKDHLEWDLTVSKPLNVELPRSMVEVVTSWNLPMSYWLNNYVFKNAL
Gene Sequence AVSFHFSNYFVGFLSEATATLAGAGFTEEKDHLEWDLTVSKPLNVELPRSMVEVVTSWNLPMSYWLNNYVFKNAL
Gene ID - Mouse ENSMUSG00000031169
Gene ID - Rat ENSRNOG00000004819
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti PORCN pAb (ATL-HPA058413 w/enhanced validation)
Datasheet Anti PORCN pAb (ATL-HPA058413 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PORCN pAb (ATL-HPA058413 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti PORCN pAb (ATL-HPA058413 w/enhanced validation)
Datasheet Anti PORCN pAb (ATL-HPA058413 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PORCN pAb (ATL-HPA058413 w/enhanced validation)

Product Description

Protein Description: porcupine homolog (Drosophila)
Gene Name: PORCN
Alternative Gene Name: DHOF, MG61, por, PORC, PPN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031169: 99%, ENSRNOG00000004819: 99%
Entrez Gene ID: 64840
Uniprot ID: Q9H237
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AVSFHFSNYFVGFLSEATATLAGAGFTEEKDHLEWDLTVSKPLNVELPRSMVEVVTSWNLPMSYWLNNYVFKNAL
Gene Sequence AVSFHFSNYFVGFLSEATATLAGAGFTEEKDHLEWDLTVSKPLNVELPRSMVEVVTSWNLPMSYWLNNYVFKNAL
Gene ID - Mouse ENSMUSG00000031169
Gene ID - Rat ENSRNOG00000004819
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti PORCN pAb (ATL-HPA058413 w/enhanced validation)
Datasheet Anti PORCN pAb (ATL-HPA058413 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PORCN pAb (ATL-HPA058413 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti PORCN pAb (ATL-HPA058413 w/enhanced validation)
Datasheet Anti PORCN pAb (ATL-HPA058413 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PORCN pAb (ATL-HPA058413 w/enhanced validation)