Description
Product Description
Protein Description: POP1 homolog, ribonuclease P/MRP subunit
Gene Name: POP1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022325: 88%, ENSRNOG00000005243: 91%
Entrez Gene ID: 10940
Uniprot ID: Q99575
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: POP1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022325: 88%, ENSRNOG00000005243: 91%
Entrez Gene ID: 10940
Uniprot ID: Q99575
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | IPILLIQQPGKVTGEDRLGWGSGWDVLLPKGWGMAFWIPFIYRGVRVGGLKESAVHSQYKRSPNVPGDFPDCPAGMLFAEEQAKNLLEKYKRR |
Gene Sequence | IPILLIQQPGKVTGEDRLGWGSGWDVLLPKGWGMAFWIPFIYRGVRVGGLKESAVHSQYKRSPNVPGDFPDCPAGMLFAEEQAKNLLEKYKRR |
Gene ID - Mouse | ENSMUSG00000022325 |
Gene ID - Rat | ENSRNOG00000005243 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti POP1 pAb (ATL-HPA066194) | |
Datasheet | Anti POP1 pAb (ATL-HPA066194) Datasheet (External Link) |
Vendor Page | Anti POP1 pAb (ATL-HPA066194) at Atlas Antibodies |
Documents & Links for Anti POP1 pAb (ATL-HPA066194) | |
Datasheet | Anti POP1 pAb (ATL-HPA066194) Datasheet (External Link) |
Vendor Page | Anti POP1 pAb (ATL-HPA066194) |