Protein Description: POP1 homolog, ribonuclease P/MRP subunit
Gene Name: POP1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022325: 88%, ENSRNOG00000005243: 91%
Entrez Gene ID: 10940
Uniprot ID: Q99575
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: POP1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022325: 88%, ENSRNOG00000005243: 91%
Entrez Gene ID: 10940
Uniprot ID: Q99575
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | IPILLIQQPGKVTGEDRLGWGSGWDVLLPKGWGMAFWIPFIYRGVRVGGLKESAVHSQYKRSPNVPGDFPDCPAGMLFAEEQAKNLLEKYKRR |
| Documents & Links for Anti POP1 pAb (ATL-HPA066194) | |
| Datasheet | Anti POP1 pAb (ATL-HPA066194) Datasheet (External Link) |
| Vendor Page | Anti POP1 pAb (ATL-HPA066194) at Atlas |
| Documents & Links for Anti POP1 pAb (ATL-HPA066194) | |
| Datasheet | Anti POP1 pAb (ATL-HPA066194) Datasheet (External Link) |
| Vendor Page | Anti POP1 pAb (ATL-HPA066194) |