Protein Description: proopiomelanocortin
Gene Name: POMC
Alternative Gene Name: ACTH, CLIP, LPH, MSH, NPP, POC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020660: 93%, ENSRNOG00000012686: 93%
Entrez Gene ID: 5443
Uniprot ID: P01189
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: POMC
Alternative Gene Name: ACTH, CLIP, LPH, MSH, NPP, POC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020660: 93%, ENSRNOG00000012686: 93%
Entrez Gene ID: 5443
Uniprot ID: P01189
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | SQCQDLTTESNLLECIRACKPDLSAETPMFPGNGDEQPLTENPRKYVMGHFRWDRFG |
| Documents & Links for Anti POMC pAb (ATL-HPA063644 w/enhanced validation) | |
| Datasheet | Anti POMC pAb (ATL-HPA063644 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti POMC pAb (ATL-HPA063644 w/enhanced validation) at Atlas |
| Documents & Links for Anti POMC pAb (ATL-HPA063644 w/enhanced validation) | |
| Datasheet | Anti POMC pAb (ATL-HPA063644 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti POMC pAb (ATL-HPA063644 w/enhanced validation) |