Anti POLR3G pAb (ATL-HPA074330)

Atlas Antibodies

Catalog No: ATL-HPA074330-25

• 

Product Description

Protein Description: RNA polymerase III subunit G
Gene Name: POLR3G
Alternative Gene Name: RPC32, RPC7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035834: 97%, ENSRNOG00000016260: 97%
Entrez Gene ID: 10622
Uniprot ID: O15318
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MAGNKGRGRAAYTFNIEAVGFSKGEKLPDV
• Gene Sequence: MAGNKGRGRAAYTFNIEAVGFSKGEKLPDV
• Gene ID - Mouse: ENSMUSG00000035834
• Gene ID - Rat: ENSRNOG00000016260
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.