Description
Product Description
Protein Description: RNA polymerase III subunit G
Gene Name: POLR3G
Alternative Gene Name: RPC32, RPC7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035834: 97%, ENSRNOG00000016260: 97%
Entrez Gene ID: 10622
Uniprot ID: O15318
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: POLR3G
Alternative Gene Name: RPC32, RPC7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035834: 97%, ENSRNOG00000016260: 97%
Entrez Gene ID: 10622
Uniprot ID: O15318
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MAGNKGRGRAAYTFNIEAVGFSKGEKLPDV |
Gene Sequence | MAGNKGRGRAAYTFNIEAVGFSKGEKLPDV |
Gene ID - Mouse | ENSMUSG00000035834 |
Gene ID - Rat | ENSRNOG00000016260 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti POLR3G pAb (ATL-HPA074330) | |
Datasheet | Anti POLR3G pAb (ATL-HPA074330) Datasheet (External Link) |
Vendor Page | Anti POLR3G pAb (ATL-HPA074330) at Atlas Antibodies |
Documents & Links for Anti POLR3G pAb (ATL-HPA074330) | |
Datasheet | Anti POLR3G pAb (ATL-HPA074330) Datasheet (External Link) |
Vendor Page | Anti POLR3G pAb (ATL-HPA074330) |