Description
Product Description
Protein Description: polymerase (RNA) III (DNA directed) polypeptide F, 39 kDa
Gene Name: POLR3F
Alternative Gene Name: RPC39, RPC6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027427: 99%, ENSRNOG00000007548: 99%
Entrez Gene ID: 10621
Uniprot ID: Q9H1D9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: POLR3F
Alternative Gene Name: RPC39, RPC6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027427: 99%, ENSRNOG00000007548: 99%
Entrez Gene ID: 10621
Uniprot ID: Q9H1D9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | IKAVKSVAASKKKVYMLYNLQPDRSVTGGAWYSDQDFESEFVEVLNQQCFKFLQSKAETARESKQNPMIQR |
Gene Sequence | IKAVKSVAASKKKVYMLYNLQPDRSVTGGAWYSDQDFESEFVEVLNQQCFKFLQSKAETARESKQNPMIQR |
Gene ID - Mouse | ENSMUSG00000027427 |
Gene ID - Rat | ENSRNOG00000007548 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti POLR3F pAb (ATL-HPA072298) | |
Datasheet | Anti POLR3F pAb (ATL-HPA072298) Datasheet (External Link) |
Vendor Page | Anti POLR3F pAb (ATL-HPA072298) at Atlas Antibodies |
Documents & Links for Anti POLR3F pAb (ATL-HPA072298) | |
Datasheet | Anti POLR3F pAb (ATL-HPA072298) Datasheet (External Link) |
Vendor Page | Anti POLR3F pAb (ATL-HPA072298) |