![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/100127/179909/atl-hpa067875_anti-polr3d-pab-atl-hpa067875_61572__24049.1681135756.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4")
Protein Description: polymerase (RNA) III (DNA directed) polypeptide D, 44kDa
Gene Name: POLR3D
Alternative Gene Name: BN51T, RPC4, TSBN51
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000776: 92%, ENSRNOG00000010028: 95%
Entrez Gene ID: 661
Uniprot ID: P05423
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: POLR3D
Alternative Gene Name: BN51T, RPC4, TSBN51
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000776: 92%, ENSRNOG00000010028: 95%
Entrez Gene ID: 661
Uniprot ID: P05423
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | LPKDVSVAELLRELSLTKEEELLFLQLPDTLPGQPPTQDIKPIKTEVQGEDGQVVLIKQE |
| Documents & Links for Anti POLR3D pAb (ATL-HPA067875) | |
| Datasheet | Anti POLR3D pAb (ATL-HPA067875) Datasheet (External Link) |
| Vendor Page | Anti POLR3D pAb (ATL-HPA067875) at Atlas |
| Documents & Links for Anti POLR3D pAb (ATL-HPA067875) | |
| Datasheet | Anti POLR3D pAb (ATL-HPA067875) Datasheet (External Link) |
| Vendor Page | Anti POLR3D pAb (ATL-HPA067875) |