Protein Description: polymerase (RNA) III (DNA directed) polypeptide D, 44kDa
Gene Name: POLR3D
Alternative Gene Name: BN51T, RPC4, TSBN51
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000776: 92%, ENSRNOG00000010028: 95%
Entrez Gene ID: 661
Uniprot ID: P05423
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: POLR3D
Alternative Gene Name: BN51T, RPC4, TSBN51
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000776: 92%, ENSRNOG00000010028: 95%
Entrez Gene ID: 661
Uniprot ID: P05423
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | LPKDVSVAELLRELSLTKEEELLFLQLPDTLPGQPPTQDIKPIKTEVQGEDGQVVLIKQE |
Documents & Links for Anti POLR3D pAb (ATL-HPA067875) | |
Datasheet | Anti POLR3D pAb (ATL-HPA067875) Datasheet (External Link) |
Vendor Page | Anti POLR3D pAb (ATL-HPA067875) at Atlas |
Documents & Links for Anti POLR3D pAb (ATL-HPA067875) | |
Datasheet | Anti POLR3D pAb (ATL-HPA067875) Datasheet (External Link) |
Vendor Page | Anti POLR3D pAb (ATL-HPA067875) |