Anti POLR3D pAb (ATL-HPA061331)

Catalog No:
ATL-HPA061331-25
$303.00

Description

Product Description

Protein Description: polymerase (RNA) III (DNA directed) polypeptide D, 44kDa
Gene Name: POLR3D
Alternative Gene Name: BN51T, RPC4, TSBN51
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000776: 98%, ENSRNOG00000010028: 98%
Entrez Gene ID: 661
Uniprot ID: P05423
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DRQREGHGRGRGRPEVIQSHSIFEQGPAEMMKKKGNWDKTVDVSDMGPSHIINIKKEKRETDEE
Gene Sequence DRQREGHGRGRGRPEVIQSHSIFEQGPAEMMKKKGNWDKTVDVSDMGPSHIINIKKEKRETDEE
Gene ID - Mouse ENSMUSG00000000776
Gene ID - Rat ENSRNOG00000010028
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti POLR3D pAb (ATL-HPA061331)
Datasheet Anti POLR3D pAb (ATL-HPA061331) Datasheet (External Link)
Vendor Page Anti POLR3D pAb (ATL-HPA061331) at Atlas Antibodies

Documents & Links for Anti POLR3D pAb (ATL-HPA061331)
Datasheet Anti POLR3D pAb (ATL-HPA061331) Datasheet (External Link)
Vendor Page Anti POLR3D pAb (ATL-HPA061331)

Product Description

Protein Description: polymerase (RNA) III (DNA directed) polypeptide D, 44kDa
Gene Name: POLR3D
Alternative Gene Name: BN51T, RPC4, TSBN51
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000776: 98%, ENSRNOG00000010028: 98%
Entrez Gene ID: 661
Uniprot ID: P05423
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DRQREGHGRGRGRPEVIQSHSIFEQGPAEMMKKKGNWDKTVDVSDMGPSHIINIKKEKRETDEE
Gene Sequence DRQREGHGRGRGRPEVIQSHSIFEQGPAEMMKKKGNWDKTVDVSDMGPSHIINIKKEKRETDEE
Gene ID - Mouse ENSMUSG00000000776
Gene ID - Rat ENSRNOG00000010028
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti POLR3D pAb (ATL-HPA061331)
Datasheet Anti POLR3D pAb (ATL-HPA061331) Datasheet (External Link)
Vendor Page Anti POLR3D pAb (ATL-HPA061331) at Atlas Antibodies

Documents & Links for Anti POLR3D pAb (ATL-HPA061331)
Datasheet Anti POLR3D pAb (ATL-HPA061331) Datasheet (External Link)
Vendor Page Anti POLR3D pAb (ATL-HPA061331)