Protein Description: polymerase (RNA) II (DNA directed) polypeptide M
Gene Name: POLR2M
Alternative Gene Name: GCOM1, Gdown, Gdown1, GRINL1A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032199: 67%, ENSRNOG00000057676: 70%
Entrez Gene ID: 81488
Uniprot ID: P0CAP2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: POLR2M
Alternative Gene Name: GCOM1, Gdown, Gdown1, GRINL1A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032199: 67%, ENSRNOG00000057676: 70%
Entrez Gene ID: 81488
Uniprot ID: P0CAP2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | SSQAEDTSSSFDNLFIDRLQRITIADQGEQQSEENASTKNLTGLSSGTEKKPHYMEVLEMRAK |
| Documents & Links for Anti POLR2M pAb (ATL-HPA068141) | |
| Datasheet | Anti POLR2M pAb (ATL-HPA068141) Datasheet (External Link) |
| Vendor Page | Anti POLR2M pAb (ATL-HPA068141) at Atlas |
| Documents & Links for Anti POLR2M pAb (ATL-HPA068141) | |
| Datasheet | Anti POLR2M pAb (ATL-HPA068141) Datasheet (External Link) |
| Vendor Page | Anti POLR2M pAb (ATL-HPA068141) |