Description
Product Description
Protein Description: polymerase (RNA) II (DNA directed) polypeptide K, 7.0kDa
Gene Name: POLR2K
Alternative Gene Name: RPB10alpha
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045996: 100%, ENSRNOG00000010408: 100%
Entrez Gene ID: 5440
Uniprot ID: P53803
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: POLR2K
Alternative Gene Name: RPB10alpha
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045996: 100%, ENSRNOG00000010408: 100%
Entrez Gene ID: 5440
Uniprot ID: P53803
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | DVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKRLV |
Gene Sequence | DVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKRLV |
Gene ID - Mouse | ENSMUSG00000045996 |
Gene ID - Rat | ENSRNOG00000010408 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti POLR2K pAb (ATL-HPA063185) | |
Datasheet | Anti POLR2K pAb (ATL-HPA063185) Datasheet (External Link) |
Vendor Page | Anti POLR2K pAb (ATL-HPA063185) at Atlas Antibodies |
Documents & Links for Anti POLR2K pAb (ATL-HPA063185) | |
Datasheet | Anti POLR2K pAb (ATL-HPA063185) Datasheet (External Link) |
Vendor Page | Anti POLR2K pAb (ATL-HPA063185) |