Description
Product Description
Protein Description: polymerase (RNA) II (DNA directed) polypeptide E, 25kDa
Gene Name: POLR2E
Alternative Gene Name: hRPB25, hsRPB5, RPABC1, RPB5, XAP4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004667: 99%, ENSRNOG00000013545: 99%
Entrez Gene ID: 5434
Uniprot ID: P19388
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: POLR2E
Alternative Gene Name: hRPB25, hsRPB5, RPABC1, RPB5, XAP4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004667: 99%, ENSRNOG00000013545: 99%
Entrez Gene ID: 5434
Uniprot ID: P19388
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ELLINITEHELVPEHVVMTKEEVTELLARYKLRENQLPRIQAGDPVARYFGIKRGQVVKIIRPSETAGRY |
Gene Sequence | ELLINITEHELVPEHVVMTKEEVTELLARYKLRENQLPRIQAGDPVARYFGIKRGQVVKIIRPSETAGRY |
Gene ID - Mouse | ENSMUSG00000004667 |
Gene ID - Rat | ENSRNOG00000013545 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti POLR2E pAb (ATL-HPA063030 w/enhanced validation) | |
Datasheet | Anti POLR2E pAb (ATL-HPA063030 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti POLR2E pAb (ATL-HPA063030 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti POLR2E pAb (ATL-HPA063030 w/enhanced validation) | |
Datasheet | Anti POLR2E pAb (ATL-HPA063030 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti POLR2E pAb (ATL-HPA063030 w/enhanced validation) |