Anti POLR2E pAb (ATL-HPA063030 w/enhanced validation)

Catalog No:
ATL-HPA063030-25
$395.00

Description

Product Description

Protein Description: polymerase (RNA) II (DNA directed) polypeptide E, 25kDa
Gene Name: POLR2E
Alternative Gene Name: hRPB25, hsRPB5, RPABC1, RPB5, XAP4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004667: 99%, ENSRNOG00000013545: 99%
Entrez Gene ID: 5434
Uniprot ID: P19388
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ELLINITEHELVPEHVVMTKEEVTELLARYKLRENQLPRIQAGDPVARYFGIKRGQVVKIIRPSETAGRY
Gene Sequence ELLINITEHELVPEHVVMTKEEVTELLARYKLRENQLPRIQAGDPVARYFGIKRGQVVKIIRPSETAGRY
Gene ID - Mouse ENSMUSG00000004667
Gene ID - Rat ENSRNOG00000013545
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links


Documents & Links for Anti POLR2E pAb (ATL-HPA063030 w/enhanced validation)
Datasheet Anti POLR2E pAb (ATL-HPA063030 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti POLR2E pAb (ATL-HPA063030 w/enhanced validation)

Product Description

Protein Description: polymerase (RNA) II (DNA directed) polypeptide E, 25kDa
Gene Name: POLR2E
Alternative Gene Name: hRPB25, hsRPB5, RPABC1, RPB5, XAP4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004667: 99%, ENSRNOG00000013545: 99%
Entrez Gene ID: 5434
Uniprot ID: P19388
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ELLINITEHELVPEHVVMTKEEVTELLARYKLRENQLPRIQAGDPVARYFGIKRGQVVKIIRPSETAGRY
Gene Sequence ELLINITEHELVPEHVVMTKEEVTELLARYKLRENQLPRIQAGDPVARYFGIKRGQVVKIIRPSETAGRY
Gene ID - Mouse ENSMUSG00000004667
Gene ID - Rat ENSRNOG00000013545
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links


Documents & Links for Anti POLR2E pAb (ATL-HPA063030 w/enhanced validation)
Datasheet Anti POLR2E pAb (ATL-HPA063030 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti POLR2E pAb (ATL-HPA063030 w/enhanced validation)