Anti POLM pAb (ATL-HPA066007)

Atlas Antibodies

Catalog No: ATL-HPA066007-25

• 
• 

Product Description

Protein Description: polymerase (DNA directed), mu
Gene Name: POLM
Alternative Gene Name: Tdt-N
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020474: 70%, ENSRNOG00000013647: 68%
Entrez Gene ID: 27434
Uniprot ID: Q9NP87
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SEATHVVMEETSAEEAVSWQERRMAAAPPGCTPPALLDISWLTESLGAGQPVPVECRHRLEVAGPRKGPLSPAWMPAYACQRPTPLTHHNTG
• Gene Sequence: SEATHVVMEETSAEEAVSWQERRMAAAPPGCTPPALLDISWLTESLGAGQPVPVECRHRLEVAGPRKGPLSPAWMPAYACQRPTPLTHHNTG
• Gene ID - Mouse: ENSMUSG00000020474
• Gene ID - Rat: ENSRNOG00000013647
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.