Description
Product Description
Protein Description: polymerase (DNA directed), mu
Gene Name: POLM
Alternative Gene Name: Tdt-N
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020474: 70%, ENSRNOG00000013647: 68%
Entrez Gene ID: 27434
Uniprot ID: Q9NP87
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: POLM
Alternative Gene Name: Tdt-N
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020474: 70%, ENSRNOG00000013647: 68%
Entrez Gene ID: 27434
Uniprot ID: Q9NP87
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SEATHVVMEETSAEEAVSWQERRMAAAPPGCTPPALLDISWLTESLGAGQPVPVECRHRLEVAGPRKGPLSPAWMPAYACQRPTPLTHHNTG |
Gene Sequence | SEATHVVMEETSAEEAVSWQERRMAAAPPGCTPPALLDISWLTESLGAGQPVPVECRHRLEVAGPRKGPLSPAWMPAYACQRPTPLTHHNTG |
Gene ID - Mouse | ENSMUSG00000020474 |
Gene ID - Rat | ENSRNOG00000013647 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti POLM pAb (ATL-HPA066007) | |
Datasheet | Anti POLM pAb (ATL-HPA066007) Datasheet (External Link) |
Vendor Page | Anti POLM pAb (ATL-HPA066007) at Atlas Antibodies |
Documents & Links for Anti POLM pAb (ATL-HPA066007) | |
Datasheet | Anti POLM pAb (ATL-HPA066007) Datasheet (External Link) |
Vendor Page | Anti POLM pAb (ATL-HPA066007) |