Description
Product Description
Protein Description: DNA polymerase lambda
Gene Name: POLL
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025218: 90%, ENSRNOG00000016748: 91%
Entrez Gene ID: 27343
Uniprot ID: Q9UGP5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: POLL
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025218: 90%, ENSRNOG00000016748: 91%
Entrez Gene ID: 27343
Uniprot ID: Q9UGP5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VVPYSEFACALLYFTGSAHFNRSMRALAKTKGMSLSEHALSTAVVRNTHGCKVGPGRVLPTPTEKDVFRLLGLPYREPAERD |
Gene Sequence | VVPYSEFACALLYFTGSAHFNRSMRALAKTKGMSLSEHALSTAVVRNTHGCKVGPGRVLPTPTEKDVFRLLGLPYREPAERD |
Gene ID - Mouse | ENSMUSG00000025218 |
Gene ID - Rat | ENSRNOG00000016748 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti POLL pAb (ATL-HPA076828) | |
Datasheet | Anti POLL pAb (ATL-HPA076828) Datasheet (External Link) |
Vendor Page | Anti POLL pAb (ATL-HPA076828) at Atlas Antibodies |
Documents & Links for Anti POLL pAb (ATL-HPA076828) | |
Datasheet | Anti POLL pAb (ATL-HPA076828) Datasheet (External Link) |
Vendor Page | Anti POLL pAb (ATL-HPA076828) |