Anti POLK pAb (ATL-HPA069375)

Atlas Antibodies

Catalog No: ATL-HPA069375-25

• 

Product Description

Protein Description: polymerase (DNA directed) kappa
Gene Name: POLK
Alternative Gene Name: DINB1, DINP, POLQ
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021668: 85%, ENSRNOG00000060626: 87%
Entrez Gene ID: 51426
Uniprot ID: Q9UBT6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HLTRDGERKSMSVERTFSEINKAEEQYSLCQELCSELAQDLQKERLKGRTVTIKLKNVNFEVKTRASTVSSVVST
• Gene Sequence: HLTRDGERKSMSVERTFSEINKAEEQYSLCQELCSELAQDLQKERLKGRTVTIKLKNVNFEVKTRASTVSSVVST
• Gene ID - Mouse: ENSMUSG00000021668
• Gene ID - Rat: ENSRNOG00000060626
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.