Anti POLK pAb (ATL-HPA068117)

Catalog No:
ATL-HPA068117-25
$447.00

Description

Product Description

Protein Description: polymerase (DNA directed) kappa
Gene Name: POLK
Alternative Gene Name: DINB1, DINP, POLQ
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021668: 95%, ENSRNOG00000060626: 92%
Entrez Gene ID: 51426
Uniprot ID: Q9UBT6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MDSTKEKCDSYKDDLLLRMGLNDNKAGMEGLDKEKINKIIMEATKGSRFYGNELKKEKQVNQRIENMMQQKAQITSQQL
Gene Sequence MDSTKEKCDSYKDDLLLRMGLNDNKAGMEGLDKEKINKIIMEATKGSRFYGNELKKEKQVNQRIENMMQQKAQITSQQL
Gene ID - Mouse ENSMUSG00000021668
Gene ID - Rat ENSRNOG00000060626
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti POLK pAb (ATL-HPA068117)
Datasheet Anti POLK pAb (ATL-HPA068117) Datasheet (External Link)
Vendor Page Anti POLK pAb (ATL-HPA068117) at Atlas Antibodies

Documents & Links for Anti POLK pAb (ATL-HPA068117)
Datasheet Anti POLK pAb (ATL-HPA068117) Datasheet (External Link)
Vendor Page Anti POLK pAb (ATL-HPA068117)

Product Description

Protein Description: polymerase (DNA directed) kappa
Gene Name: POLK
Alternative Gene Name: DINB1, DINP, POLQ
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021668: 95%, ENSRNOG00000060626: 92%
Entrez Gene ID: 51426
Uniprot ID: Q9UBT6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MDSTKEKCDSYKDDLLLRMGLNDNKAGMEGLDKEKINKIIMEATKGSRFYGNELKKEKQVNQRIENMMQQKAQITSQQL
Gene Sequence MDSTKEKCDSYKDDLLLRMGLNDNKAGMEGLDKEKINKIIMEATKGSRFYGNELKKEKQVNQRIENMMQQKAQITSQQL
Gene ID - Mouse ENSMUSG00000021668
Gene ID - Rat ENSRNOG00000060626
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti POLK pAb (ATL-HPA068117)
Datasheet Anti POLK pAb (ATL-HPA068117) Datasheet (External Link)
Vendor Page Anti POLK pAb (ATL-HPA068117) at Atlas Antibodies

Documents & Links for Anti POLK pAb (ATL-HPA068117)
Datasheet Anti POLK pAb (ATL-HPA068117) Datasheet (External Link)
Vendor Page Anti POLK pAb (ATL-HPA068117)