Description
Product Description
Protein Description: polymerase (DNA directed) kappa
Gene Name: POLK
Alternative Gene Name: DINB1, DINP, POLQ
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021668: 95%, ENSRNOG00000060626: 92%
Entrez Gene ID: 51426
Uniprot ID: Q9UBT6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: POLK
Alternative Gene Name: DINB1, DINP, POLQ
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021668: 95%, ENSRNOG00000060626: 92%
Entrez Gene ID: 51426
Uniprot ID: Q9UBT6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MDSTKEKCDSYKDDLLLRMGLNDNKAGMEGLDKEKINKIIMEATKGSRFYGNELKKEKQVNQRIENMMQQKAQITSQQL |
Gene Sequence | MDSTKEKCDSYKDDLLLRMGLNDNKAGMEGLDKEKINKIIMEATKGSRFYGNELKKEKQVNQRIENMMQQKAQITSQQL |
Gene ID - Mouse | ENSMUSG00000021668 |
Gene ID - Rat | ENSRNOG00000060626 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti POLK pAb (ATL-HPA068117) | |
Datasheet | Anti POLK pAb (ATL-HPA068117) Datasheet (External Link) |
Vendor Page | Anti POLK pAb (ATL-HPA068117) at Atlas Antibodies |
Documents & Links for Anti POLK pAb (ATL-HPA068117) | |
Datasheet | Anti POLK pAb (ATL-HPA068117) Datasheet (External Link) |
Vendor Page | Anti POLK pAb (ATL-HPA068117) |