Protein Description: polymerase (DNA directed), gamma 2, accessory subunit
Gene Name: POLG2
Alternative Gene Name: HP55, MTPOLB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020718: 86%, ENSRNOG00000013728: 89%
Entrez Gene ID: 11232
Uniprot ID: Q9UHN1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: POLG2
Alternative Gene Name: HP55, MTPOLB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020718: 86%, ENSRNOG00000013728: 89%
Entrez Gene ID: 11232
Uniprot ID: Q9UHN1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | LDRGMLAYLYDSFQLTENSFTRKKNLHRKVLKLHPCLAPIKVALDVGRGPTLELRQVCQGLFNELLENGISVWPGYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKE |
| Documents & Links for Anti POLG2 pAb (ATL-HPA023202) | |
| Datasheet | Anti POLG2 pAb (ATL-HPA023202) Datasheet (External Link) |
| Vendor Page | Anti POLG2 pAb (ATL-HPA023202) at Atlas |
| Documents & Links for Anti POLG2 pAb (ATL-HPA023202) | |
| Datasheet | Anti POLG2 pAb (ATL-HPA023202) Datasheet (External Link) |
| Vendor Page | Anti POLG2 pAb (ATL-HPA023202) |