Anti POLE4 pAb (ATL-HPA071815)

Atlas Antibodies

Catalog No: ATL-HPA071815-25

• 

Product Description

Protein Description: polymerase (DNA-directed), epsilon 4, accessory subunit
Gene Name: POLE4
Alternative Gene Name: p12
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030042: 100%, ENSRNOG00000006102: 100%
Entrez Gene ID: 56655
Uniprot ID: Q9NR33
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GQEAIFILARAAELFVETIAKDAYCCAQQGKRKTLQRRDLDNAIEAVDEFAFLEGTLD
• Gene Sequence: GQEAIFILARAAELFVETIAKDAYCCAQQGKRKTLQRRDLDNAIEAVDEFAFLEGTLD
• Gene ID - Mouse: ENSMUSG00000030042
• Gene ID - Rat: ENSRNOG00000006102
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.