Protein Description: polymerase (DNA directed), epsilon, catalytic subunit
Gene Name: POLE
Alternative Gene Name: POLE1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000007080: 95%, ENSRNOG00000037449: 95%
Entrez Gene ID: 5426
Uniprot ID: Q07864
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: POLE
Alternative Gene Name: POLE1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000007080: 95%, ENSRNOG00000037449: 95%
Entrez Gene ID: 5426
Uniprot ID: Q07864
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | QGYLITNREIVSEDIEDFEFTPKPEYEGPFCVFNEPDEAHLIQRWFEHVQETKPTIMVTYNGDFFDWPFVEARAAVHGLSMQQEI |
Documents & Links for Anti POLE pAb (ATL-HPA067385) | |
Datasheet | Anti POLE pAb (ATL-HPA067385) Datasheet (External Link) |
Vendor Page | Anti POLE pAb (ATL-HPA067385) at Atlas |
Documents & Links for Anti POLE pAb (ATL-HPA067385) | |
Datasheet | Anti POLE pAb (ATL-HPA067385) Datasheet (External Link) |
Vendor Page | Anti POLE pAb (ATL-HPA067385) |