Protein Description: polymerase (DNA-directed), delta 4, accessory subunit
Gene Name: POLD4
Alternative Gene Name: p12, POLDS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000097508: 84%, ENSRNOG00000018765: 86%
Entrez Gene ID: 57804
Uniprot ID: Q9HCU8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: POLD4
Alternative Gene Name: p12, POLDS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000097508: 84%, ENSRNOG00000018765: 86%
Entrez Gene ID: 57804
Uniprot ID: Q9HCU8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | WQYGPCTGITRLQRWCRAKQMGLEPPPEVWQVLKTHPGDPRFQCSLWHLYP |
Documents & Links for Anti POLD4 pAb (ATL-HPA071529) | |
Datasheet | Anti POLD4 pAb (ATL-HPA071529) Datasheet (External Link) |
Vendor Page | Anti POLD4 pAb (ATL-HPA071529) at Atlas |
Documents & Links for Anti POLD4 pAb (ATL-HPA071529) | |
Datasheet | Anti POLD4 pAb (ATL-HPA071529) Datasheet (External Link) |
Vendor Page | Anti POLD4 pAb (ATL-HPA071529) |