Anti POLD3 pAb (ATL-HPA058846 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA058846-25

• 
• 

Product Description

Protein Description: polymerase (DNA-directed), delta 3, accessory subunit
Gene Name: POLD3
Alternative Gene Name: KIAA0039, P66, P68, PPP1R128
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030726: 75%, ENSRNOG00000018411: 75%
Entrez Gene ID: 10714
Uniprot ID: Q15054
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SVTEPKLATPAGLKKSSKKAEPVKVLQKEKKRGKRVALSDDETKETENMRKKRRRIKLPESDSSEDEVFPDSPGAY
• Gene Sequence: SVTEPKLATPAGLKKSSKKAEPVKVLQKEKKRGKRVALSDDETKETENMRKKRRRIKLPESDSSEDEVFPDSPGAY
• Gene ID - Mouse: ENSMUSG00000030726
• Gene ID - Rat: ENSRNOG00000018411
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations

Citations for Anti POLD3 pAb (ATL-HPA058846 w/enhanced validation) – 1 Found

Brosnan-Cashman, Jacqueline A; Yuan, Ming; Graham, Mindy K; Rizzo, Anthony J; Myers, Kaylar M; Davis, Christine; Zhang, Rebecca; Esopi, David M; Raabe, Eric H; Eberhart, Charles G; Heaphy, Christopher M; Meeker, Alan K. ATRX loss induces multiple hallmarks of the alternative lengthening of telomeres (ALT) phenotype in human glioma cell lines in a cell line-specific manner. Plos One. 13(9):e0204159.