Protein Description: podocalyxin-like
Gene Name: PODXL
Alternative Gene Name: Gp200, PC, PCLP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025608: 43%, ENSRNOG00000012495: 41%
Entrez Gene ID: 5420
Uniprot ID: O00592
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PODXL
Alternative Gene Name: Gp200, PC, PCLP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025608: 43%, ENSRNOG00000012495: 41%
Entrez Gene ID: 5420
Uniprot ID: O00592
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | LPETMSSSPTAASTTHRYPKTPSPTVAHESNWAKCEDLETQTQSEKQLVLNLTGNTLCAGGASDEKLISLICRAVKATFNPAQDKCGIRLASVPGSQTVVVKEITIHTKLPAKDVYERLKDKWDELKEAGVSDMKLGD |
Documents & Links for Anti PODXL pAb (ATL-HPA002110 w/enhanced validation) | |
Datasheet | Anti PODXL pAb (ATL-HPA002110 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti PODXL pAb (ATL-HPA002110 w/enhanced validation) at Atlas |
Documents & Links for Anti PODXL pAb (ATL-HPA002110 w/enhanced validation) | |
Datasheet | Anti PODXL pAb (ATL-HPA002110 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti PODXL pAb (ATL-HPA002110 w/enhanced validation) |
Citations for Anti PODXL pAb (ATL-HPA002110 w/enhanced validation) – 13 Found |
Saukkonen, Kapo; Hagström, Jaana; Mustonen, Harri; Juuti, Anne; Nordling, Stig; Fermér, Christian; Nilsson, Olle; Seppänen, Hanna; Haglund, Caj. Podocalyxin Is a Marker of Poor Prognosis in Pancreatic Ductal Adenocarcinoma. Plos One. 10(6):e0129012. PubMed |
Larsson, Anna H; Lehn, Sophie; Wangefjord, Sakarias; Karnevi, Emelie; Kuteeva, Eugenia; Sundström, Magnus; Nodin, Björn; Uhlén, Mathias; Eberhard, Jakob; Birgisson, Helgi; Jirström, Karin. Significant association and synergistic adverse prognostic effect of podocalyxin-like protein and epidermal growth factor receptor expression in colorectal cancer. Journal Of Translational Medicine. 2016;14(1):128. PubMed |
Kusumoto, Hidenori; Shintani, Yasushi; Kanzaki, Ryu; Kawamura, Tomohiro; Funaki, Soichiro; Minami, Masato; Nagatomo, Izumi; Morii, Eiichi; Okumura, Meinoshin. Podocalyxin influences malignant potential by controlling epithelial-mesenchymal transition in lung adenocarcinoma. Cancer Science. 2017;108(3):528-535. PubMed |
Borg, David; Larsson, Anna H; Hedner, Charlotta; Nodin, Björn; Johnsson, Anders; Jirström, Karin. Podocalyxin-like protein as a predictive biomarker for benefit of neoadjuvant chemotherapy in resectable gastric and esophageal adenocarcinoma. Journal Of Translational Medicine. 2018;16(1):290. PubMed |
Marx, David; Caillard, Sophie; Olagne, Jérôme; Moulin, Bruno; Hannedouche, Thierry; Touchard, Guy; Dupuis, Arnaud; Gachet, Christian; Molitor, Anne; Bahram, Seiamak; Carapito, Raphael. Atypical focal segmental glomerulosclerosis associated with a new PODXL nonsense variant. Molecular Genetics & Genomic Medicine. 2021;9(5):e1658. PubMed |
Cheung, H-H; Davis, A J; Lee, T-L; Pang, A L; Nagrani, S; Rennert, O M; Chan, W-Y. Methylation of an intronic region regulates miR-199a in testicular tumor malignancy. Oncogene. 2011;30(31):3404-15. PubMed |
Larsson, A; Johansson, M E; Wangefjord, S; Gaber, A; Nodin, B; Kucharzewska, P; Welinder, C; Belting, M; Eberhard, J; Johnsson, A; Uhlén, M; Jirström, K. Overexpression of podocalyxin-like protein is an independent factor of poor prognosis in colorectal cancer. British Journal Of Cancer. 2011;105(5):666-72. PubMed |
Dallas, Matthew R; Chen, Shih-Hsun; Streppel, Mirte M; Sharma, Sidharth; Maitra, Anirban; Konstantopoulos, Konstantinos. Sialofucosylated podocalyxin is a functional E- and L-selectin ligand expressed by metastatic pancreatic cancer cells. American Journal Of Physiology. Cell Physiology. 2012;303(6):C616-24. PubMed |
Boman, K; Larsson, A H; Segersten, U; Kuteeva, E; Johannesson, H; Nodin, B; Eberhard, J; Uhlén, M; Malmström, P-U; Jirström, K. Membranous expression of podocalyxin-like protein is an independent factor of poor prognosis in urothelial bladder cancer. British Journal Of Cancer. 2013;108(11):2321-8. PubMed |
Forsström, Björn; Axnäs, Barbara Bisławska; Stengele, Klaus-Peter; Bühler, Jochen; Albert, Thomas J; Richmond, Todd A; Hu, Francis Jingxin; Nilsson, Peter; Hudson, Elton P; Rockberg, Johan; Uhlen, Mathias. Proteome-wide epitope mapping of antibodies using ultra-dense peptide arrays. Molecular & Cellular Proteomics : Mcp. 2014;13(6):1585-97. PubMed |
Heby, Margareta; Elebro, Jakob; Nodin, Björn; Jirström, Karin; Eberhard, Jakob. Prognostic and predictive significance of podocalyxin-like protein expression in pancreatic and periampullary adenocarcinoma. Bmc Clinical Pathology. 15( 26028992):10. PubMed |
Borg, David; Hedner, Charlotta; Nodin, Björn; Larsson, Anna; Johnsson, Anders; Eberhard, Jakob; Jirström, Karin. Expression of podocalyxin-like protein is an independent prognostic biomarker in resected esophageal and gastric adenocarcinoma. Bmc Clinical Pathology. 16( 27478410):13. PubMed |
Li, Aijun; Muenst, Simone; Hoffman, Julius; Starck, Laurent; Sarem, Melika; Fischer, Andreas; Hutter, Gregor; Shastri, V Prasad. Mesenchymal-endothelial nexus in breast cancer spheroids induces vasculogenesis and local invasion in a CAM model. Communications Biology. 2022;5(1):1303. PubMed |