Protein Description: pyridoxamine 5'-phosphate oxidase
Gene Name: PNPO
Alternative Gene Name: PDXPO
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018659: 92%, ENSRNOG00000046493: 90%
Entrez Gene ID: 55163
Uniprot ID: Q9NVS9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PNPO
Alternative Gene Name: PDXPO
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018659: 92%, ENSRNOG00000046493: 90%
Entrez Gene ID: 55163
Uniprot ID: Q9NVS9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | SSVIPDREYLRKKNEELEQLYQDQEVPKPKSWGGYVLYPQVMEFWQGQTNRLHDRIVFRRGLPTGDSPLGPMTHRGEEDWLYERLAP |
| Documents & Links for Anti PNPO pAb (ATL-HPA023204 w/enhanced validation) | |
| Datasheet | Anti PNPO pAb (ATL-HPA023204 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti PNPO pAb (ATL-HPA023204 w/enhanced validation) at Atlas |
| Documents & Links for Anti PNPO pAb (ATL-HPA023204 w/enhanced validation) | |
| Datasheet | Anti PNPO pAb (ATL-HPA023204 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti PNPO pAb (ATL-HPA023204 w/enhanced validation) |
| Citations for Anti PNPO pAb (ATL-HPA023204 w/enhanced validation) – 1 Found |
| Fux, Anja; Pfanzelt, Martin; Kirsch, Volker C; Hoegl, Annabelle; Sieber, Stephan A. Customizing Functionalized Cofactor Mimics to Study the Human Pyridoxal 5'-Phosphate-Binding Proteome. Cell Chemical Biology. 2019;26(10):1461-1468.e7. PubMed |