Anti PNPLA6 pAb (ATL-HPA064773)

Catalog No:
ATL-HPA064773-25
$447.00

Description

Product Description

Protein Description: patatin like phospholipase domain containing 6
Gene Name: PNPLA6
Alternative Gene Name: iPLA2delta, NTE, SPG39, sws
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004565: 99%, ENSRNOG00000000977: 97%
Entrez Gene ID: 10908
Uniprot ID: Q8IY17
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SYCEDESATGGCPFGPYQGRQTSSIFEAAKQELAKLMRIEDPSLLNSRVLLHHAKAGTIIARQGDQDVSLHFVLWG
Gene Sequence SYCEDESATGGCPFGPYQGRQTSSIFEAAKQELAKLMRIEDPSLLNSRVLLHHAKAGTIIARQGDQDVSLHFVLWG
Gene ID - Mouse ENSMUSG00000004565
Gene ID - Rat ENSRNOG00000000977
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti PNPLA6 pAb (ATL-HPA064773)
Datasheet Anti PNPLA6 pAb (ATL-HPA064773) Datasheet (External Link)
Vendor Page Anti PNPLA6 pAb (ATL-HPA064773) at Atlas Antibodies

Documents & Links for Anti PNPLA6 pAb (ATL-HPA064773)
Datasheet Anti PNPLA6 pAb (ATL-HPA064773) Datasheet (External Link)
Vendor Page Anti PNPLA6 pAb (ATL-HPA064773)

Product Description

Protein Description: patatin like phospholipase domain containing 6
Gene Name: PNPLA6
Alternative Gene Name: iPLA2delta, NTE, SPG39, sws
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004565: 99%, ENSRNOG00000000977: 97%
Entrez Gene ID: 10908
Uniprot ID: Q8IY17
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SYCEDESATGGCPFGPYQGRQTSSIFEAAKQELAKLMRIEDPSLLNSRVLLHHAKAGTIIARQGDQDVSLHFVLWG
Gene Sequence SYCEDESATGGCPFGPYQGRQTSSIFEAAKQELAKLMRIEDPSLLNSRVLLHHAKAGTIIARQGDQDVSLHFVLWG
Gene ID - Mouse ENSMUSG00000004565
Gene ID - Rat ENSRNOG00000000977
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti PNPLA6 pAb (ATL-HPA064773)
Datasheet Anti PNPLA6 pAb (ATL-HPA064773) Datasheet (External Link)
Vendor Page Anti PNPLA6 pAb (ATL-HPA064773) at Atlas Antibodies

Documents & Links for Anti PNPLA6 pAb (ATL-HPA064773)
Datasheet Anti PNPLA6 pAb (ATL-HPA064773) Datasheet (External Link)
Vendor Page Anti PNPLA6 pAb (ATL-HPA064773)