Protein Description: patatin like phospholipase domain containing 6
Gene Name: PNPLA6
Alternative Gene Name: iPLA2delta, NTE, SPG39, sws
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004565: 99%, ENSRNOG00000000977: 97%
Entrez Gene ID: 10908
Uniprot ID: Q8IY17
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PNPLA6
Alternative Gene Name: iPLA2delta, NTE, SPG39, sws
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004565: 99%, ENSRNOG00000000977: 97%
Entrez Gene ID: 10908
Uniprot ID: Q8IY17
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | SYCEDESATGGCPFGPYQGRQTSSIFEAAKQELAKLMRIEDPSLLNSRVLLHHAKAGTIIARQGDQDVSLHFVLWG |
| Documents & Links for Anti PNPLA6 pAb (ATL-HPA064773) | |
| Datasheet | Anti PNPLA6 pAb (ATL-HPA064773) Datasheet (External Link) |
| Vendor Page | Anti PNPLA6 pAb (ATL-HPA064773) at Atlas |
| Documents & Links for Anti PNPLA6 pAb (ATL-HPA064773) | |
| Datasheet | Anti PNPLA6 pAb (ATL-HPA064773) Datasheet (External Link) |
| Vendor Page | Anti PNPLA6 pAb (ATL-HPA064773) |