Protein Description: patatin like phospholipase domain containing 2
Gene Name: PNPLA2
Alternative Gene Name: ATGL, desnutrin, FP17548, iPLA2zeta, TTS-2.2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025509: 88%, ENSRNOG00000018736: 87%
Entrez Gene ID: 57104
Uniprot ID: Q96AD5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PNPLA2
Alternative Gene Name: ATGL, desnutrin, FP17548, iPLA2zeta, TTS-2.2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025509: 88%, ENSRNOG00000018736: 87%
Entrez Gene ID: 57104
Uniprot ID: Q96AD5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | FSGESDICPQDSSTNIHELRVTNTSIQFNLRNLYRLSKALFPPEPLVLREMCKQGYRDGLRFLQRNGLLNRPNPLLALPPARPHGPEDKDQA |
| Documents & Links for Anti PNPLA2 pAb (ATL-HPA075175) | |
| Datasheet | Anti PNPLA2 pAb (ATL-HPA075175) Datasheet (External Link) |
| Vendor Page | Anti PNPLA2 pAb (ATL-HPA075175) at Atlas |
| Documents & Links for Anti PNPLA2 pAb (ATL-HPA075175) | |
| Datasheet | Anti PNPLA2 pAb (ATL-HPA075175) Datasheet (External Link) |
| Vendor Page | Anti PNPLA2 pAb (ATL-HPA075175) |