Anti PNOC pAb (ATL-HPA056724 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA056724-25

• 

Product Description

Protein Description: prepronociceptin
Gene Name: PNOC
Alternative Gene Name: N/OFQ, NOP, PPNOC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045731: 71%, ENSRNOG00000014231: 76%
Entrez Gene ID: 5368
Uniprot ID: Q13519
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RVRSLFQEQEEPEPGMEEAGEMEQKQLQKRFGGFTGARKSARKLANQKRFSEFMRQYLVLSMQSSQ
• Gene Sequence: RVRSLFQEQEEPEPGMEEAGEMEQKQLQKRFGGFTGARKSARKLANQKRFSEFMRQYLVLSMQSSQ
• Gene ID - Mouse: ENSMUSG00000045731
• Gene ID - Rat: ENSRNOG00000014231
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.