Description
Product Description
Protein Description: prepronociceptin
Gene Name: PNOC
Alternative Gene Name: N/OFQ, NOP, PPNOC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045731: 71%, ENSRNOG00000014231: 76%
Entrez Gene ID: 5368
Uniprot ID: Q13519
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PNOC
Alternative Gene Name: N/OFQ, NOP, PPNOC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045731: 71%, ENSRNOG00000014231: 76%
Entrez Gene ID: 5368
Uniprot ID: Q13519
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | RVRSLFQEQEEPEPGMEEAGEMEQKQLQKRFGGFTGARKSARKLANQKRFSEFMRQYLVLSMQSSQ |
Gene Sequence | RVRSLFQEQEEPEPGMEEAGEMEQKQLQKRFGGFTGARKSARKLANQKRFSEFMRQYLVLSMQSSQ |
Gene ID - Mouse | ENSMUSG00000045731 |
Gene ID - Rat | ENSRNOG00000014231 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti PNOC pAb (ATL-HPA056724 w/enhanced validation) | |
Datasheet | Anti PNOC pAb (ATL-HPA056724 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti PNOC pAb (ATL-HPA056724 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti PNOC pAb (ATL-HPA056724 w/enhanced validation) | |
Datasheet | Anti PNOC pAb (ATL-HPA056724 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti PNOC pAb (ATL-HPA056724 w/enhanced validation) |