Protein Description: PNMA family member 5
Gene Name: PNMA5
Alternative Gene Name: KIAA1934
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050424: 61%, ENSRNOG00000058423: 61%
Entrez Gene ID: 114824
Uniprot ID: Q96PV4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PNMA5
Alternative Gene Name: KIAA1934
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050424: 61%, ENSRNOG00000058423: 61%
Entrez Gene ID: 114824
Uniprot ID: Q96PV4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | KSPLSVRSTDMIRLKHLLARVAMTPALRGKLELLDQRGCPPNFLELMKLIRDEEEWENTEAVMKNKEKPSGR |
| Documents & Links for Anti PNMA5 pAb (ATL-HPA073946 w/enhanced validation) | |
| Datasheet | Anti PNMA5 pAb (ATL-HPA073946 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti PNMA5 pAb (ATL-HPA073946 w/enhanced validation) at Atlas |
| Documents & Links for Anti PNMA5 pAb (ATL-HPA073946 w/enhanced validation) | |
| Datasheet | Anti PNMA5 pAb (ATL-HPA073946 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti PNMA5 pAb (ATL-HPA073946 w/enhanced validation) |