Protein Description: peptidase (mitochondrial processing) beta
Gene Name: PMPCB
Alternative Gene Name: MPPB, MPPP52
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029017: 85%, ENSRNOG00000012693: 86%
Entrez Gene ID: 9512
Uniprot ID: O75439
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PMPCB
Alternative Gene Name: MPPB, MPPP52
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029017: 85%, ENSRNOG00000012693: 86%
Entrez Gene ID: 9512
Uniprot ID: O75439
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | SEVARARNLLKTNMLLQLDGSTPICEDIGRQMLCYNRRIPIPELEARIDAVNAETIREVCTKYIYNRSPAIAAVGPIKQLPDFKQIRSNMCWLR |
| Documents & Links for Anti PMPCB pAb (ATL-HPA074168) | |
| Datasheet | Anti PMPCB pAb (ATL-HPA074168) Datasheet (External Link) |
| Vendor Page | Anti PMPCB pAb (ATL-HPA074168) at Atlas |
| Documents & Links for Anti PMPCB pAb (ATL-HPA074168) | |
| Datasheet | Anti PMPCB pAb (ATL-HPA074168) Datasheet (External Link) |
| Vendor Page | Anti PMPCB pAb (ATL-HPA074168) |