Protein Description: peptidase (mitochondrial processing) alpha
Gene Name: PMPCA
Alternative Gene Name: Alpha-MPP, INPP5E, KIAA0123
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026926: 96%, ENSRNOG00000026775: 96%
Entrez Gene ID: 23203
Uniprot ID: Q10713
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PMPCA
Alternative Gene Name: Alpha-MPP, INPP5E, KIAA0123
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026926: 96%, ENSRNOG00000026775: 96%
Entrez Gene ID: 23203
Uniprot ID: Q10713
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | YLNVLNRHHWMYNATSYHHSYEDTGLLCIHASADPRQVREMVEIITKEFILMGGTVDTVELERAKTQLTSMLMMNLES |
Documents & Links for Anti PMPCA pAb (ATL-HPA063735 w/enhanced validation) | |
Datasheet | Anti PMPCA pAb (ATL-HPA063735 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti PMPCA pAb (ATL-HPA063735 w/enhanced validation) at Atlas |
Documents & Links for Anti PMPCA pAb (ATL-HPA063735 w/enhanced validation) | |
Datasheet | Anti PMPCA pAb (ATL-HPA063735 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti PMPCA pAb (ATL-HPA063735 w/enhanced validation) |