Protein Description: phosphomannomutase 2
Gene Name: PMM2
Alternative Gene Name: CDG1, CDG1a, CDGS, PMI, PMI1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022711: 93%, ENSRNOG00000002615: 93%
Entrez Gene ID: 5373
Uniprot ID: O15305
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PMM2
Alternative Gene Name: CDG1, CDG1a, CDGS, PMI, PMI1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022711: 93%, ENSRNOG00000002615: 93%
Entrez Gene ID: 5373
Uniprot ID: O15305
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | FEKVQEQLGNDVVEKYDYVFPENGLVAYKDGKLLCRQNIQS |
| Documents & Links for Anti PMM2 pAb (ATL-HPA063649 w/enhanced validation) | |
| Datasheet | Anti PMM2 pAb (ATL-HPA063649 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti PMM2 pAb (ATL-HPA063649 w/enhanced validation) at Atlas |
| Documents & Links for Anti PMM2 pAb (ATL-HPA063649 w/enhanced validation) | |
| Datasheet | Anti PMM2 pAb (ATL-HPA063649 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti PMM2 pAb (ATL-HPA063649 w/enhanced validation) |