Anti PMM1 pAb (ATL-HPA074950)

Catalog No:
ATL-HPA074950-25
$447.00

Description

Product Description

Protein Description: phosphomannomutase 1
Gene Name: PMM1
Alternative Gene Name: Sec53
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022474: 94%, ENSRNOG00000005358: 94%
Entrez Gene ID: 5372
Uniprot ID: Q92871
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YCLDSLDQDSFDTIHFFGNETSPGGNDFEIFADPRTVGHSVVSPQDTVQRCREIFFPETAHEA
Gene Sequence YCLDSLDQDSFDTIHFFGNETSPGGNDFEIFADPRTVGHSVVSPQDTVQRCREIFFPETAHEA
Gene ID - Mouse ENSMUSG00000022474
Gene ID - Rat ENSRNOG00000005358
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti PMM1 pAb (ATL-HPA074950)
Datasheet Anti PMM1 pAb (ATL-HPA074950) Datasheet (External Link)
Vendor Page Anti PMM1 pAb (ATL-HPA074950) at Atlas Antibodies

Documents & Links for Anti PMM1 pAb (ATL-HPA074950)
Datasheet Anti PMM1 pAb (ATL-HPA074950) Datasheet (External Link)
Vendor Page Anti PMM1 pAb (ATL-HPA074950)

Product Description

Protein Description: phosphomannomutase 1
Gene Name: PMM1
Alternative Gene Name: Sec53
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022474: 94%, ENSRNOG00000005358: 94%
Entrez Gene ID: 5372
Uniprot ID: Q92871
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YCLDSLDQDSFDTIHFFGNETSPGGNDFEIFADPRTVGHSVVSPQDTVQRCREIFFPETAHEA
Gene Sequence YCLDSLDQDSFDTIHFFGNETSPGGNDFEIFADPRTVGHSVVSPQDTVQRCREIFFPETAHEA
Gene ID - Mouse ENSMUSG00000022474
Gene ID - Rat ENSRNOG00000005358
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti PMM1 pAb (ATL-HPA074950)
Datasheet Anti PMM1 pAb (ATL-HPA074950) Datasheet (External Link)
Vendor Page Anti PMM1 pAb (ATL-HPA074950) at Atlas Antibodies

Documents & Links for Anti PMM1 pAb (ATL-HPA074950)
Datasheet Anti PMM1 pAb (ATL-HPA074950) Datasheet (External Link)
Vendor Page Anti PMM1 pAb (ATL-HPA074950)