Protein Description: prostate transmembrane protein, androgen induced 1
Gene Name: PMEPA1
Alternative Gene Name: STAG1, TMEPAI
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038400: 88%, ENSRNOG00000050404: 86%
Entrez Gene ID: 56937
Uniprot ID: Q969W9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PMEPA1
Alternative Gene Name: STAG1, TMEPAI
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038400: 88%, ENSRNOG00000050404: 86%
Entrez Gene ID: 56937
Uniprot ID: Q969W9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | VNSTAAAAAGQPNVSCTCNCKRSLFQSMEITELE |
Documents & Links for Anti PMEPA1 pAb (ATL-HPA072291) | |
Datasheet | Anti PMEPA1 pAb (ATL-HPA072291) Datasheet (External Link) |
Vendor Page | Anti PMEPA1 pAb (ATL-HPA072291) at Atlas |
Documents & Links for Anti PMEPA1 pAb (ATL-HPA072291) | |
Datasheet | Anti PMEPA1 pAb (ATL-HPA072291) Datasheet (External Link) |
Vendor Page | Anti PMEPA1 pAb (ATL-HPA072291) |