Anti PMEPA1 pAb (ATL-HPA072291)

Atlas Antibodies

Catalog No: ATL-HPA072291-25

• 
• 

Product Description

Protein Description: prostate transmembrane protein, androgen induced 1
Gene Name: PMEPA1
Alternative Gene Name: STAG1, TMEPAI
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038400: 88%, ENSRNOG00000050404: 86%
Entrez Gene ID: 56937
Uniprot ID: Q969W9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VNSTAAAAAGQPNVSCTCNCKRSLFQSMEITELE
• Gene Sequence: VNSTAAAAAGQPNVSCTCNCKRSLFQSMEITELE
• Gene ID - Mouse: ENSMUSG00000038400
• Gene ID - Rat: ENSRNOG00000050404
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.