Description
Product Description
Protein Description: plexin A3
Gene Name: PLXNA3
Alternative Gene Name: 6.3, Plxn3, PLXN4, SEX, XAP-6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031398: 84%, ENSRNOG00000060464: 86%
Entrez Gene ID: 55558
Uniprot ID: P51805
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PLXNA3
Alternative Gene Name: 6.3, Plxn3, PLXN4, SEX, XAP-6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031398: 84%, ENSRNOG00000060464: 86%
Entrez Gene ID: 55558
Uniprot ID: P51805
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SSLDAGSRVTVTVRDSECQFVRRDAKAIVCISPLSTLGPSQAPITLAIDRANISSPGLIYTYTQDPTVTRLEPTWSIINGSTA |
Gene Sequence | SSLDAGSRVTVTVRDSECQFVRRDAKAIVCISPLSTLGPSQAPITLAIDRANISSPGLIYTYTQDPTVTRLEPTWSIINGSTA |
Gene ID - Mouse | ENSMUSG00000031398 |
Gene ID - Rat | ENSRNOG00000060464 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti PLXNA3 pAb (ATL-HPA058989) | |
Datasheet | Anti PLXNA3 pAb (ATL-HPA058989) Datasheet (External Link) |
Vendor Page | Anti PLXNA3 pAb (ATL-HPA058989) at Atlas Antibodies |
Documents & Links for Anti PLXNA3 pAb (ATL-HPA058989) | |
Datasheet | Anti PLXNA3 pAb (ATL-HPA058989) Datasheet (External Link) |
Vendor Page | Anti PLXNA3 pAb (ATL-HPA058989) |