Protein Description: plexin domain containing 2
Gene Name: PLXDC2
Alternative Gene Name: FLJ14623, TEM7R
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026748: 86%, ENSRNOG00000000142: 87%
Entrez Gene ID: 84898
Uniprot ID: Q6UX71
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PLXDC2
Alternative Gene Name: FLJ14623, TEM7R
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026748: 86%, ENSRNOG00000000142: 87%
Entrez Gene ID: 84898
Uniprot ID: Q6UX71
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | SHRWKRNLDFLKAVDTNRASVGQDSPEPRSFTDLLLDDGQDNNTQIEEDTDHNYYISRIYGPSDSASRDLW |
| Gene ID - Mouse | ENSMUSG00000026748 |
| Gene ID - Rat | ENSMUSG00000026748 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PLXDC2 pAb (ATL-HPA070793) | |
| Datasheet | Anti PLXDC2 pAb (ATL-HPA070793) Datasheet (External Link) |
| Vendor Page | Anti PLXDC2 pAb (ATL-HPA070793) at Atlas |
| Documents & Links for Anti PLXDC2 pAb (ATL-HPA070793) | |
| Datasheet | Anti PLXDC2 pAb (ATL-HPA070793) Datasheet (External Link) |
| Vendor Page | Anti PLXDC2 pAb (ATL-HPA070793) |